FGF10_MOUSE O35565
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35565
Recommended name：Fibroblast growth factor 10
EC number：
Alternative names：(FGF-10) (Keratinocyte growth factor 2)
Cleaved into：
GeneID：14165
Gene names (primary )：Fgf10
Gene names (synonym )：
Gene names (ORF )：
Length：209
Mass：23597
Sequence：MWKWILTHCASAFPHLPGCCCCFLLLFLVSSFPVTCQALGQDMVSQEATNCSSSSSSFSSPSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT
Tissue specificity：Expressed abundantly in embryos and the lung, and at much lower levels in brain and heart.
Induction：
Developmental stage：
Protein families：Heparin-binding growth factors family