FCERG_MOUSE P20491
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P20491
Recommended name：High affinity immunoglobulin epsilon receptor subunit gamma
EC number：
Alternative names：(Fc receptor gamma-chain) (FcRgamma) (Fc-epsilon RI-gamma) (IgE Fc receptor subunit gamma) (FceRI gamma)
Cleaved into：
GeneID：14127
Gene names (primary )：Fcer1g
Gene names (synonym )：Fce1g
Gene names (ORF )：
Length：86
Mass：9652
Sequence：MISAVILFLLLLVEQAAALGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREKADAVYTGLNTRSQETYETLKHEKPPQ
Tissue specificity：Expressed in mast cells (at protein level) (PubMed:14764707). Expressed in basophils (at protein level) (PubMed:19098920). {ECO:0000269|PubMed:14764707, ECO:0000269|PubMed:19098920}.
Induction：
Developmental stage：
Protein families：CD3Z/FCER1G family