FXL17_MOUSE   Q9QZN1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QZN1

Recommended name:F-box/LRR-repeat protein 17

EC number:

Alternative names:(F-box and leucine-rich repeat protein 17) (F-box only protein 13)

Cleaved into:

GeneID:50758

Gene names  (primary ):Fbxl17

Gene names  (synonym ):Fbl17 Fbx13 Fbxo13

Gene names  (ORF ):

Length:701

Mass:75683

Sequence:MGHLLSKEPRNRPSQKRPRCCSWCRRRRPLLRLPRRALAKASPQPAAPRSRDCFFRGPCMLCFIVHSPGAPASAGLEEEPPLSPPPPPPRDGAYAAVSSQHLARRYAALAAEDCAAAARRFLLSSAAAAAAAASSPASCCKELGLAAAAAWEQQGRSLFLAGVGPVRFLGPLAAVQLFRAPPAPPPQAEPATALEMVCKRKGAGVPACTPCKQPRCGCGGCGGGGGGGGGPAGGGASPPRPPDAGCCQAPEQPPPPLCPAPASPASECAPIVAAAGDTVRAGGTAPSSAQQQPESGDADCQEPPENPCDCHREPPPEIPDINQLPPSILLKIFSNLSLNERCLSASLVCKYWRDLCLDFQFWKQLDLSSRQQVTDELLEKIASRSQNIIEINISDCRSLSDSGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSRCRELKDIHFGQCYKISDEGMIVIAKSCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLVSCKITDYALIAIGRYSVTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNELTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAATS

Tissue specificity:

Induction:

Developmental stage:

Protein families:FBXL17 family


   💬 WhatsApp