FITM2_MOUSE P59266
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P59266
Recommended name：Fat storage-inducing transmembrane protein 2
EC number：
Alternative names：(Fat-inducing protein 2)
Cleaved into：
GeneID：228859
Gene names (primary )：Fitm2
Gene names (synonym )：Fit2
Gene names (ORF )：
Length：262
Mass：30016
Sequence：MEHLERCAWFLRGTLVRATVRRHLPWALVAAMLAGSVVKELSPLPESYLSNKRNVLNVYFVKLAWAWTVCLLLPFIALTNYHLTGKTSLVLRRLSTLLVGTAIWYICTALFSNIEHYTGSCYQSPALEGIRQEHRSKQQCHREGGFWHGFDISGHSFLLTFCALMIVEEMAVLHEVKTDRGHHLHAAITTLVVALGFLTFIWVWMFLCTAVYFHDLTQKVFGTMFGLLGWYGTYGYWYLKSFSPGLPPQSCSLTLKRDTYKK
Tissue specificity：Widely expressed, with highest levels in white and brown adipose tissues (at protein level). In the heart, mRNA expression levels do not correlate well with protein levels, suggesting post-transcriptional regulation in this organ. {ECO:0000269|PubMed:18160536}.
Induction：
Developmental stage：
Protein families：FIT family