FITM1_MOUSE Q91V79
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91V79
Recommended name：Fat storage-inducing transmembrane protein 1
EC number：
Alternative names：(Fat-inducing protein 1)
Cleaved into：
GeneID：68680
Gene names (primary )：Fitm1
Gene names (synonym )：Fit1
Gene names (ORF )：
Length：292
Mass：32280
Sequence：MERGPTVGAGLGAGTRVRALLGCLVKVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWLAAVVIFGPLLQFHVNSRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLATRRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRKSCLAAGHQWRGYTVSSHTFLLTFCCLLMAEEAAVFAKYLAHGLPAGAPLRLVFLLNVLLLGLWNFLLLCTVIYFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGIPGHGLFPRSRSMRKHN
Tissue specificity：Predominantly expressed in skeletal muscle and at lower levels in the heart (at protein level). In the heart, mRNA expression levels do not correlate well with protein levels, suggesting post-transcriptional regulation in this organ. {ECO:0000269|PubMed:18160536}.
Induction：
Developmental stage：
Protein families：FIT family