EXOS6_MOUSE   Q8BTW3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BTW3

Recommended name:Exosome complex component MTR3

EC number:

Alternative names:(Exosome component 6) (mRNA transport regulator 3 homolog)

Cleaved into:

GeneID:72544

Gene names  (primary ):Exosc6

Gene names  (synonym ):Mtr3

Gene names  (ORF ):

Length:273

Mass:28370

Sequence:MPGDHRRIRGPEESQPPQLYAAEDDETPAARDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPRQAEGGERGSGPAGAGGEAPAALRGRLLCDFRRAPFSGRRRRAPQGGGGEDRELGLALQEALEPAVRLGRYPRAQLEVSALLLEDGGCALAAALTAAALALADAGVEMYDLVVGCGLSLTPGPSPTWLLDPTRLEEEHSAAGLTVALMPVLNQVAGLLGSGEGGQTESWTDAVRLGLEGCQRLYPVLQQCLVRAARRRGAAAPP

Tissue specificity:

Induction:

Developmental stage:

Protein families:RNase PH family


   💬 WhatsApp