EXOS3_MOUSE   Q7TQK4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TQK4

Recommended name:Exosome complex component RRP40

EC number:EC 3.1.13.-

Alternative names:(Exosome component 3) (Ribosomal RNA-processing protein 40)

Cleaved into:

GeneID:66362

Gene names  (primary ):Exosc3

Gene names  (synonym ):Rrp40

Gene names  (ORF ):

Length:274

Mass:29546

Sequence:MAEVLSAGPESVAGCRARAVHKVLNQVVLPGEELVLPDHEDVDGLGGAGEQPLRLNAGARPRLRVVCGPGLRRCGDRLLVTKCGRLRHKEPSGGGGGVYWVDSQQKRYVPVKGDHVIGIVIAKSGDIFKVDVGGSEPASLSYLAFEGATKRNRPNVQVGDLIYGQCVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIVQELGKLYPLEIVFGMNGRIWVKAKTIQQTLILANVLEACEHMTTEQRKQIFARLAES

Tissue specificity:

Induction:

Developmental stage:

Protein families:RRP40 family


   💬 WhatsApp