PPDPF_MOUSE   Q9CR37


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CR37

Recommended name:Pancreatic progenitor cell differentiation and proliferation factor

EC number:

Alternative names:(Exocrine differentiation and proliferation factor)

Cleaved into:

GeneID:66496

Gene names  (primary ):Ppdpf

Gene names  (synonym ):Exdpf

Gene names  (ORF ):

Length:115

Mass:12260

Sequence:MAAIPSSGSLVATHDYYRRRLGSSSSSSSGGSAEYPGDAVLQSPGLPKADPGHWWASFFFGKSTLPFMTTVLESPERSAESPQVSRSPMTCGLTPETMKQQPVIHSGQTNPRDLS

Tissue specificity:

Induction:

Developmental stage:

Protein families:PPDPF family


   💬 WhatsApp