SH21B_MOUSE O35324
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35324
Recommended name:SH2 domain-containing protein 1B
EC number:
Alternative names:(EWS/FLI1-activated transcript 2) (EAT-2)
Cleaved into:
GeneID:
Gene names (primary ):Sh2d1b
Gene names (synonym ):Eat2 Eat2a Sh2d1b1
Gene names (ORF ):
Length:132
Mass:15259
Sequence:MDLPYYHGCLTKRECEALLLKGGVDGNFLIRDSESVPGALCLCVSFKKLVYSYRIFREKHGYYRIETDAHTPRTIFPNLQELVSKYGKPGQGLVVHLSNPIMRNNLCQRGRRMELELNVYENTDEEYVDVLP
Tissue specificity:Expressed in spleen, thymus, lung, kidney, heart, colon and small bowel. Expressed in NK cells (all stages of cell maturation), macrophages and dendritic cells. {ECO:0000269|PubMed:16127454, ECO:0000269|PubMed:16425036, ECO:0000269|PubMed:24687958}.
Induction:
Developmental stage:
Protein families: