IF2H_MOUSE Q9Z0N2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z0N2
Recommended name：Eukaryotic translation initiation factor 2 subunit 3, Y-linked
EC number：EC 3.6.5.3
Alternative names：(Eukaryotic translation initiation factor 2 subunit gamma, Y-linked) (eIF-2-gamma Y) (Spermatogonial proliferation factor) (Spy)
Cleaved into：
GeneID：26908
Gene names (primary )：Eif2s3y
Gene names (synonym )：
Gene names (ORF )：
Length：472
Mass：51131
Sequence：MAGGEAGVTLGQPHLSRQDLATLDVTKLTPLSREIISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDSSCPRPECYRSCGSSTPDEFPSDIPGTKGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPLRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDGEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTIDDE
Tissue specificity：Widely expressed. In the adult brain, high levels in hippocampus, habenula, hypothalamic nuclei and cerebellum. Also expressed in embryonic brain. {ECO:0000269|PubMed:12023983, ECO:0000269|PubMed:16325480, ECO:0000269|PubMed:9736774}.
Induction：
Developmental stage：
Protein families：TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, EIF2G subfamily