IF2G_MOUSE Q9Z0N1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z0N1
Recommended name:Eukaryotic translation initiation factor 2 subunit 3, X-linked
EC number:EC 3.6.5.3
Alternative names:(Eukaryotic translation initiation factor 2 subunit gamma, X-linked) (eIF-2-gamma X)
Cleaved into:
GeneID:26905
Gene names (primary ):Eif2s3x
Gene names (synonym ):
Gene names (ORF ):
Length:472
Mass:51065
Sequence:MAGGEGGVTLGQPHLSRQDLATLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYKLDDPSCPRPECYRSCGSSTPDEFPTDIPGTKGNFKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKESQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQEIEVRPGIVSKDSEGKLMCKPIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQVLGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD
Tissue specificity:Widely expressed. In the brain, high mRNA levels are observed in specific regions, including the habenula, anterodorsal thalamic nucleus, hippocampus, hypothalamus, and cerebellum. Also expressed in the embryonic brain. There is a differential expression between males and females, wich is tissue-specific. Females tend to have higher expression levels than males in the brain (cortex, hippocampus and paraventricular nucleus, but not in the habenula), as well as in other tissues. The up-regulation observed in females at the mRNA level may be due to the presence of 2 active copies of the gene. {ECO:0000269|PubMed:12023983, ECO:0000269|PubMed:16325480, ECO:0000269|PubMed:9736774}.
Induction:
Developmental stage:
Protein families:TRAFAC class translation factor GTPase superfamily, Classic translation factor GTPase family, EIF2G subfamily