VP37D_MOUSE   Q810I0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q810I0

Recommended name:Vacuolar protein sorting-associated protein 37D

EC number:

Alternative names:(ESCRT-I complex subunit VPS37D) (Williams-Beuren syndrome region protein 24 homolog)

Cleaved into:

GeneID:194309

Gene names  (primary ):Vps37d

Gene names  (synonym ):Wbscr24

Gene names  (ORF ):

Length:261

Mass:28563

Sequence:MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLERDACLASNYALAKENLALRPRLEMGRTALAIKYQELREVAENCADKLQRLEKSMHRWSPQCALGWLQAELEEAEQEAEVQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQEVLRRRERSAQPAPTTAAAAAAAATAMDPPKPFPAAAVLPTGAARGPPPAVPRSLPPLDSRPVPPVKGSPGCPFGPAPLLSPRPSQPEPPHR

Tissue specificity:

Induction:

Developmental stage:

Protein families:VPS37 family


   💬 WhatsApp