MB12B_MOUSE   Q6KAU4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6KAU4

Recommended name:Multivesicular body subunit 12B

EC number:

Alternative names:(ESCRT-I complex subunit MVB12B) (Protein FAM125B)

Cleaved into:

GeneID:72543

Gene names  (primary ):Mvb12b

Gene names  (synonym ):Fam125b

Gene names  (ORF ):

Length:317

Mass:35411

Sequence:MRSCFCVRRSRDPPPPQPPPPQRGTDQATMPEVKELSEALPETPMDPITGVGVVASRNRAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDVKDTLPVGFIPIQETVDTQEVVFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIGELNSMGIWYRMGRVPRNHDSSQPTTPSQSSASSTPAPNLPRHISLTLPATFRGRNNTSTDYEYQLSNLYAISAMDGVPFMISEKFSCIPESMQPFDLLGITIKSLAEIEKEYEYSFRTEQSAAARLPPSPTRCQQIPQS

Tissue specificity:

Induction:

Developmental stage:

Protein families:MVB12 family


   💬 WhatsApp