HBE_MOUSE P02104
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P02104
Recommended name：Hemoglobin subunit epsilon-Y2
EC number：
Alternative names：(Epsilon-Y2-globin) (Hemoglobin epsilon-Y2 chain)
Cleaved into：
GeneID：15135
Gene names (primary )：Hbb-y
Gene names (synonym )：
Gene names (ORF )：
Length：147
Mass：16137
Sequence：MVNFTAEEKTLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLSSASAIMGNPRVKAHGKKVLTAFGESIKNLDNLKSALAKLSELHCDKLHVDPENFKLLGNVLVIVLASHFGNEFTAEMQAAWQKLVAGVATALSHKYH
Tissue specificity：High expression in yolk sac blood islands, fetal liver, and embryonic erythrocytes. Very low levels in adult liver and spleen.
Induction：
Developmental stage：
Protein families：Globin family