TMPS2_MOUSE   Q9JIQ8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JIQ8

Recommended name:Transmembrane protease serine 2

EC number:EC 3.4.21.-

Alternative names:(Epitheliasin) (Plasmic transmembrane protein X)

Cleaved into:Transmembrane protease serine 2 non-catalytic chain; Transmembrane protease serine 2 catalytic chain

GeneID:50528

Gene names  (primary ):Tmprss2

Gene names  (synonym ):

Gene names  (ORF ):

Length:490

Mass:53526

Sequence:MALNSGSPPGIGPCYENHGYQSEHICPPRPPVAPNGYNLYPAQYYPSPVPQYAPRITTQASTSVIHTHPKSSGALCTSKSKKSLCLALALGTVLTGAAVAAVLLWRFWDSNCSTSEMECGSSGTCISSSLWCDGVAHCPNGEDENRCVRLYGQSFILQVYSSQRKAWYPVCQDDWSESYGRAACKDMGYKNNFYSSQGIPDQSGATSFMKLNVSSGNVDLYKKLYHSDSCSSRMVVSLRCIECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQGVHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDLVKPVCLPNPGMMLDLDQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITPAMICAGFLQGSVDSCQGDSGGPLVTLKNGIWWLIGDTSWGSGCAKALRPGVYGNVTVFTDWIYQQMRANS

Tissue specificity:Larynx, trachea and bronchi, lung, prostate and kidney. {ECO:0000269|PubMed:11169526, ECO:0000269|PubMed:24522916}.

Induction:

Developmental stage:

Protein families:Peptidase S1 family


   💬 WhatsApp