EPGN_MOUSE   Q924X1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q924X1

Recommended name:Epigen

EC number:

Alternative names:(Epithelial mitogen) (EPG)

Cleaved into:

GeneID:71920

Gene names  (primary ):Epgn

Gene names  (synonym ):

Gene names  (ORF ):

Length:152

Mass:16799

Sequence:MALGVLIAVCLLFKAMKAALSEEAEVIPPSTAQQSNWTFNNTEADYIEEPVALKFSHPCLEDHNSYCINGACAFHHELKQAICRCFTGYTGQRCEHLTLTSYAVDSYEKYIAIGIGVGLLISAFLAVFYCYIRKRCINLKSPYIICSGGSPL

Tissue specificity:Expressed at low levels in testis, heart and liver. {ECO:0000269|PubMed:11278323}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp