K1KB9_MOUSE P15949
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P15949
Recommended name：Kallikrein 1-related peptidase b9
EC number：EC 3.4.21.35
Alternative names：(Epidermal growth factor-binding protein type C) (EGF-BP C) (Glandular kallikrein K9) (mGK-9) (Tissue kallikrein-9)
Cleaved into：
GeneID：13648
Gene names (primary )：Klk1b9
Gene names (synonym )：Egfbp3 Klk-9 Klk9
Gene names (ORF )：
Length：261
Mass：28900
Sequence：MRFLILFLALSLGGIDAAPPVHSRIVGGFKCEKNSQPWHVAVYRYNEYICGGVLLDANWVLTAAHCYYEENKVSLGKNNLYEEEPSAQHRLVSKSFLHPGYNRSLHRNHIRHPEYDYSNDLMLLRLSKPADITDVVKPIALPTEEPKLGSTCLASGWGSTTPFKFQNAKDLQCVNLKLLPNEDCGKAHIEKVTDVMLCAGETDGGKDTCKGDSGGPLICDGVLQGITSWGFTPCGEPKKPGVYTKLIKFTSWIKDTMAKNL
Tissue specificity：
Induction：
Developmental stage：
Protein families：Peptidase S1 family, Kallikrein subfamily