PRG3_MOUSE   Q9JL95


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JL95

Recommended name:Proteoglycan 3

EC number:

Alternative names:(Eosinophil major basic protein 2)

Cleaved into:

GeneID:53856

Gene names  (primary ):Prg3

Gene names  (synonym ):Mbp2

Gene names  (ORF ):

Length:222

Mass:25204

Sequence:MKQPLILSFLLLGMVSAFHLETAHLENPKREESLKQEADGSREQGRELALTQETKQTEGEEVEGSQHQDIFEDEEAMESDPDALNKDSACPKEEDTTHFQGTPGCKSCNYVLVRTPETFDKAQRVCRRCYRGNLASVHSYSFNYQIQNLARKINQSIVWIGGILRGWFWKKFCWMDGSCWDFGYWAPGQPGSGGGHCVTLCTKGGHWRRASCKSHLPFICSF

Tissue specificity:Expressed in bone marrow, spleen, and thymus. Not detected in heart, liver or lung. {ECO:0000269|PubMed:10770291}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp