CO8A2_MOUSE P25318
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P25318
Recommended name:Collagen alpha-2(VIII) chain
EC number:
Alternative names:(Endothelial collagen)
Cleaved into:
GeneID:329941
Gene names (primary ):Col8a2
Gene names (synonym ):
Gene names (ORF ):
Length:699
Mass:66943
Sequence:MQGALMPLPSLLLLLLGCGPRVSSGGGAGGAAGYAPVKYVQPMQKGPVGPPFREGKGQYLEMPLPMLPMDLKGEPGPPGKPGPRGPPGPPGFPGKPGTGKPGVHGQPGPAGPPGFSRMGKAGPPGLPGKVGPPGQPGLRGEPGIRGDQGLRGPPGPPGLPGPSGITVPGKPGAQGAPGPPGFRGEPGPQGEPGPRGDRGLKGDNGVGQPGLPGAPGQAGAPGPPGLPGPAGLGKPGLDGIPGAPGDKGDSGPPGVPGSRGEPGAVGPKGPPGVDGVGIPGAAGVPGPQGPVGAKGEPGLRGPPGLIGPVGYGMPGKPGPKGDRGPVGAPGLLGDRGEPGEDGKPGEQGPQGLGGPPGLPGSAGLPGRRGPPGSKGEVGPGGPPGVPGIRGDQGPNGLAGKPGLPGERGLPGAHGPPGPTGPKGEPGFTGRPGGPGVAGALGQKGDLGLPGQPGLRGPSGIPGLQGPAGPIGPQGLPGLKGEPGLPGPPGEGKVGEPGSAGPTGPPGVPGSPGLTGPPGPPGPPGPPGAPGALDETGIAGLHLPNGGVEGAVLGKGGKPQFGLGELSAHATPAFTAVLTSPFPASGMPVRFDRTLYNGHSGYNPATGIFTCPVGGVYYFAYHVHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQASGGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFSGFLLCPT
Tissue specificity:In the kidney, expressed in mesangial cells, glomerular endothelial cells, and tubular epithelial cells. {ECO:0000269|PubMed:19401424}.
Induction:
Developmental stage:
Protein families: