TXND5_MOUSE Q91W90
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91W90
Recommended name：Thioredoxin domain-containing protein 5
EC number：
Alternative names：(Endoplasmic reticulum resident protein 46) (ER protein 46) (ERp46) (Plasma cell-specific thioredoxin-related protein) (PC-TRP) (Thioredoxin-like protein p46)
Cleaved into：
GeneID：105245
Gene names (primary )：Txndc5
Gene names (synonym )：Tlp46
Gene names (ORF )：
Length：417
Mass：46415
Sequence：MPPRPGRLLQPLAGLPALATLLLLLGARKGARAQEVEADSGVEQDPHAKHLYTADMFTHGIQSAAHFVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPATPEPEAEPPRAPELKQGLYELSANNFELHVSQGNHFIKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKSFEDTIAQGITFVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVGEHNGGRDLDSLHSFVLRQAKDEL
Tissue specificity：Expressed at high levels in plasma cells and at very low levels in all other cells and tissues examined (at protein level). {ECO:0000269|PubMed:14971039}.
Induction：
Developmental stage：
Protein families：Protein disulfide isomerase family