HMCES_MOUSE   Q8R1M0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R1M0

Recommended name:Abasic site processing protein HMCES

EC number:EC 3.4.-.-

Alternative names:(Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein) (ES cell-specific 5hmC-binding protein) (Peptidase HMCES) (SRAP domain-containing protein 1)

Cleaved into:

GeneID:232210

Gene names  (primary ):Hmces

Gene names  (synonym ):Srap1 Srapd1

Gene names  (ORF ):

Length:353

Mass:40169

Sequence:MCGRTSCHLPREVLTRACAYQDRQGRRRLPQWRDPDKYCPSYNKSPQSSSPVLLSRLHFEKDADSSDRIIIPMRWGLVPSWFKESDPSKLQFNTTNCRSDTIMEKQSFKVPLGKGRRCVVLADGFYEWQRCQGTNQRQPYFIYFPQIKTEKSGGNDASDSSDNKEKVWDNWRLLTMAGIFDCWEAPGGECLYSYSIITVDSCRGLSDIHSRMPAILDGEEAVSKWLDFGEVATQEALKLIHPIDNITFHPVSPVVNNSRNNTPECLAPADLLVKKEPKANGSSQRMMQWLATKSPKKEVPDSPKKDASGLPQWSSQFLQKSPLPAKRGATSSFLDRWLKQEKEDEPMAKKPNS

Tissue specificity:Expressed in embryonic stem cells. {ECO:0000269|PubMed:29020633}.

Induction:

Developmental stage:

Protein families:SOS response-associated peptidase family


   💬 WhatsApp