IF5A2_MOUSE   Q8BGY2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BGY2

Recommended name:Eukaryotic translation initiation factor 5A-2

EC number:

Alternative names:(eIF-5A-2) (eIF-5A2) (Eukaryotic initiation factor 5A isoform 2)

Cleaved into:

GeneID:208691

Gene names  (primary ):Eif5a2

Gene names  (synonym ):

Gene names  (ORF ):

Length:153

Mass:16793

Sequence:MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK

Tissue specificity:

Induction:

Developmental stage:

Protein families:EIF-5A family


   💬 WhatsApp