IF4E2_MOUSE Q8BMB3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BMB3
Recommended name：Eukaryotic translation initiation factor 4E type 2
EC number：
Alternative names：(eIF-4E type 2) (eIF4E type 2) (eIF4E-2) (mRNA cap-binding protein type 2) (Eukaryotic translation initiation factor 4E-like 3) (eIF4E-like protein 4E-LP)
Cleaved into：
GeneID：26987
Gene names (primary )：Eif4e2
Gene names (synonym )：Eif4el3
Gene names (ORF )：
Length：245
Mass：28263
Sequence：MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
Tissue specificity：Widely expressed with highest levels in testis, kidney and liver. {ECO:0000269|PubMed:15153109}.
Induction：
Developmental stage：
Protein families：Eukaryotic initiation factor 4E family