EIF3M_MOUSE   Q99JX4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99JX4

Recommended name:Eukaryotic translation initiation factor 3 subunit M

EC number:

Alternative names:(eIF3m) (PCI domain-containing protein 1)

Cleaved into:

GeneID:98221

Gene names  (primary ):Eif3m

Gene names  (synonym ):Pcid1

Gene names  (ORF ):

Length:374

Mass:42517

Sequence:MSVPAFIDISEEDQAAELRAYLKSKGAELSEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWKLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT

Tissue specificity:

Induction:

Developmental stage:

Protein families:EIF-3 subunit M family


   💬 WhatsApp