EI3JA_MOUSE   Q3UGC7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UGC7

Recommended name:Eukaryotic translation initiation factor 3 subunit J-A

EC number:

Alternative names:(eIF3j-A) (Eukaryotic translation initiation factor 3 subunit 1-A) (eIF-3-alpha-A) (eIF3 p35)

Cleaved into:

GeneID:78655

Gene names  (primary ):Eif3j1

Gene names  (synonym ):Eif3s1-1

Gene names  (ORF ):

Length:261

Mass:29344

Sequence:MAAAAAAAAAAGDSDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDDDDENKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYEGGYVQDYEDFM

Tissue specificity:

Induction:

Developmental stage:

Protein families:EIF-3 subunit J family


   💬 WhatsApp