EGFB2_MOUSE   P36368


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P36368

Recommended name:Epidermal growth factor-binding protein type B

EC number:EC 3.4.21.119

Alternative names:(EGF-BP B) (Glandular kallikrein K13) (mGK-13) (Prorenin-converting enzyme 1) (PRECE-1) (Tissue kallikrein 13)

Cleaved into:

GeneID:13647

Gene names  (primary ):Egfbp2

Gene names  (synonym ):Egfbp-2 Klk-13 Klk13

Gene names  (ORF ):

Length:261

Mass:28689

Sequence:MWFLILFLALSLGGIDAAPPLQSRVVGGFNCKKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSNDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSITPTRWQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA

Tissue specificity:

Induction:

Developmental stage:

Protein families:Peptidase S1 family, Kallikrein subfamily


   💬 WhatsApp