NECA1_MOUSE Q8BG18
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BG18
Recommended name：N-terminal EF-hand calcium-binding protein 1
EC number：
Alternative names：(EF-hand calcium-binding protein 1)
Cleaved into：
GeneID：69352
Gene names (primary )：Necab1
Gene names (synonym )：Efcbp1
Gene names (ORF )：
Length：352
Mass：40934
Sequence：MEDSRETSPSSNNSSEELSSTLQLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFHTIDTHNTNNLDTEELCEYFSQHLGEYENVLAALEDLNLSILKAMGKTKKDYQEASNLEQFVTRFLLKETLNQLQSLQNSLECAMETTEEQTRQERQGPSKPEVLSIQWPGKRSSRRVQRHNSFSPNSPQFNVSSPALLEEDNQWMTQINRLQKLIDRLEKKDLKLEPLEEEIIEENTKPHIMLVQRQMSVTEEDLEEFQLALKHYVESASAQSGCLRISIQKLSNESRYMIYEFWENSSVWNRHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILNNN
Tissue specificity：Expressed in brain (at protein level). Expressed in the cerebral cortex only in layer 4, thalamic nuclei (the mediodorsal nucleus), hippocampus (a small band of pyramidal neurons at the boundary between CA1 and CA3), interneurons interspersed throughout the hippocampus proper, interneurons in the hilus, bodies of the neurons but also their dendritic projections (at protein level). {ECO:0000269|PubMed:12044471}.
Induction：
Developmental stage：
Protein families：