EF2KT_MOUSE   Q3UZW7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3UZW7

Recommended name:Protein-lysine N-methyltransferase EEF2KMT

EC number:EC 2.1.1.-

Alternative names:(eEF2-lysine methyltransferase) (eEF2-KMT)

Cleaved into:

GeneID:70511

Gene names  (primary ):Eef2kmt

Gene names  (synonym ):Fam86 Fam86a

Gene names  (ORF ):

Length:335

Mass:36940

Sequence:MAPEDHEGATSLLQSFERRFLAARALPSFPWQSLEEKLKDPSGSELLLAILQRTVKHPVCVQHGPSVKYARCFLSKLIKKHEAVPTEPLDALYEALAEVLMTQESTQCHRSYLLPSGNSVTLSESTAIVSHGTTGLVTWDAALYLAEWAIENPAAFTDRTILELGSGAGLTGLAICKACCPRAYIFSDCHAQVLEQLRGNVLLNGFSLEPHTPIDAGSSKVTVAQLDWDEVTASQLSAFQADVVIAADVLYCWEMTLSLVRVLKMLEDCQRKSAPDVYVAYTIRSQDTGKLFIEELDRAGIYWEEVPPHTGKLFPYEEHSAIVILKLVLTSRHGV

Tissue specificity:

Induction:

Developmental stage:

Protein families:Class I-like SAM-binding methyltransferase superfamily, EEF2KMT family


   💬 WhatsApp