ENDOV_MOUSE Q8C9A2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C9A2
Recommended name:Endonuclease V
EC number:EC 3.1.26.-
Alternative names:
Cleaved into:
GeneID:338371
Gene names (primary ):Endov
Gene names (synonym ):
Gene names (ORF ):
Length:338
Mass:37174
Sequence:MAHTAAERPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFVKGDSVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLVELVQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKKLLQVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPLYVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRRTLGQLGVAPAQRKDRSQKEQRPNACPQGGPGALADQGRPPECDGRDSSSDRKAPEPGFQEQKDQQLEGTGHQEDSDLWPPSPAWVQSPP
Tissue specificity:Highest levels detected in liver with high levels also found in heart, kidney and testis. Expressed at low levels in brain. {ECO:0000269|PubMed:12853604}.
Induction:
Developmental stage:
Protein families:Endonuclease V family