D42E1_MOUSE Q9D665
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D665
Recommended name：Short-chain dehydrogenase/reductase family 42E member 1
EC number：EC 1.1.1.-
Alternative names：
Cleaved into：
GeneID：74032
Gene names (primary )：Sdr42e1
Gene names (synonym )：
Gene names (ORF )：
Length：394
Mass：43894
Sequence：MDSPRFPEETVLITGGGGYFGFRLGCALNQKGARVILFDITQPAQNLPEGIKFVCGDIRCLADVETAFQDAEKVACVFHVASYGMSGREQLNKTQIEEVNVGGTENILRACLERGVPRLVYTSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEKKVLEANGLAFKQGDGILRTCAIRPAGIYGAGEQRHLPRIVSYIERGLFRFVYGDPQSLVEFVHVDNLAKAHILASEALKADKGHVASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRLPLTLIYCLAFLVEMTHFIVGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGFEPQPFDLQEVVEWFKAHGHGRGAAGQDSEFMLWDGILILLLALSVLTWILPSTTLSI
Tissue specificity：
Induction：
Developmental stage：
Protein families：3-beta-HSD family