UBE2S_MOUSE   Q921J4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q921J4

Recommended name:Ubiquitin-conjugating enzyme E2 S

EC number:EC 2.3.2.23

Alternative names:(E2 ubiquitin-conjugating enzyme S) (Ubiquitin carrier protein S) (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-conjugating enzyme E2-EPF5) (Ubiquitin-protein ligase S)

Cleaved into:

GeneID:77891

Gene names  (primary ):Ube2s

Gene names  (synonym ):E2epf

Gene names  (ORF ):

Length:223

Mass:24183

Sequence:MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGPNGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGACSTSSGRAEATQDLASGASASSADPMIPGVLGGAEGPMAKKHAGERDKKLAAKKKLDKKRALRRL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Ubiquitin-conjugating enzyme family


   💬 WhatsApp