UB2G1_MOUSE P62254
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62254
Recommended name：Ubiquitin-conjugating enzyme E2 G1
EC number：EC 2.3.2.23
Alternative names：(E2 ubiquitin-conjugating enzyme G1) (E217K) (UBC7) (Ubiquitin carrier protein G1) (Ubiquitin-protein ligase G1)
Cleaved into：Ubiquitin-conjugating enzyme E2 G1, N-terminally processed
GeneID：67128
Gene names (primary )：Ube2g1
Gene names (synonym )：Ube2g
Gene names (ORF )：
Length：170
Mass：19509
Sequence：MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
Tissue specificity：
Induction：
Developmental stage：
Protein families：Ubiquitin-conjugating enzyme family