PPR27_MOUSE   Q9D119


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D119

Recommended name:Protein phosphatase 1 regulatory subunit 27

EC number:

Alternative names:(Dysferlin-interacting protein 1)

Cleaved into:

GeneID:68701

Gene names  (primary ):Ppp1r27

Gene names  (synonym ):Dysfip1

Gene names  (ORF ):

Length:154

Mass:17436

Sequence:MPSRTVRYARYSPRQRRRRMLADRSVRFPNDVLFLDHIRQGDLEQVGRFIRARKVSLDTIHPSGLAALHEAVLSGNLECVKLLVKYGADIHQRDETGWTPLHIACSDGYPDIARYLISLGADRDAANDDGDLPSDLIDPDFKDLVELFKGTSMD

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp