DLRB2_MOUSE   Q9DAJ5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DAJ5

Recommended name:Dynein light chain roadblock-type 2

EC number:

Alternative names:(Dynein light chain 2B, cytoplasmic)

Cleaved into:

GeneID:75465

Gene names  (primary ):Dynlrb2

Gene names  (synonym ):Dncl2b Dnlc2b

Gene names  (ORF ):

Length:96

Mass:10876

Sequence:MTEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE

Tissue specificity:

Induction:

Developmental stage:

Protein families:GAMAD family


   💬 WhatsApp