DXO_MOUSE   O70348


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O70348

Recommended name:Decapping and exoribonuclease protein

EC number:EC 3.6.1.-

Alternative names:(DXO) (5'-3' exoribonuclease DXO) (Dom-3 homolog Z) (NAD-capped RNA hydrolase DXO) (DeNADding enzyme DXO) (EC 3.6.1.-)

Cleaved into:

GeneID:112403

Gene names  (primary ):Dxo

Gene names  (synonym ):Dom3z Ng6

Gene names  (ORF ):

Length:397

Mass:45280

Sequence:MEPRGTKRKAEKTEVEKPLNKLPRAVPSLRTQPSLYSGPFPFYRRPSELGCFSLDAQRQYHGDARALRYYSPPPINGPGPDFDLRDGYPDRYQPRDEEVQERLDHLLRWVLEHRNQLEGGPGWLAGATVTWRGHLTKLLTTPYERQEGWQLAASRFQGTLYLSEVETPAARAQRLARPPLLRELMYMGYKFEQYMCADKPGGSPDPSGEVNTNVAYCSVLRSRLGNHPLLFSGEVDCLNPQAPCTQPPSCYVELKTSKEMHSPGQWRSFYRHKLLKWWAQSFLPGVPHVVAGFRNPEGFVCSLKTFPTMEMFENVRNDREGWNPSVCMNFCAAFLSFAQSTVVQDDPRLVHLFSWEPGGPVTVSVHRDAPYAFLPSWYVETMTQDLPPLSKTPSPKD

Tissue specificity:

Induction:

Developmental stage:

Protein families:DXO/Dom3Z family


   💬 WhatsApp