DPEP1_MOUSE   P31428


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P31428

Recommended name:Dipeptidase 1

EC number:EC 3.4.13.19

Alternative names:(DPEP-1) (Beta-lactamase) (Membrane-bound dipeptidase 1) (MBD-1) (Microsomal dipeptidase) (Renal dipeptidase)

Cleaved into:

GeneID:13479

Gene names  (primary ):Dpep1

Gene names  (synonym ):Mbd1 Rdp

Gene names  (ORF ):

Length:410

Mass:45722

Sequence:MVIIWWFWSLLAICASDSFRDQAVAIMRTTPVIDGHNDLPWQLLNLFNNQLLRPDADLNKLAQTHTNIPKLKAGFVGGQFWSAYMPCDTQNKDAVKRILEQMDVIHRMCQLYPETFMCVTNSSDILQAFRRGKVASLIGVEGGHLIDSSLGVLRTLYHLGMRYLTLTHNCNTPWADNWLVDRGDDEAESHGLSPFGKRLLNEMNRLGVMIDLSHVSVATMKDALQISRAPVIFSHSSAYSLCPHRRNVPDDVLQLVKNTSSLVMVNFFSNFVSCSDSATLPQVADHLDHIKKVAGAGAVGLGGDYDGVTMLPVGLEDVSKYPDLIAELLRRNWTETEVRGLLADNLIRVFSEVELVSNNMQSPEEVPITLKELDGSCRTYYGYSQAHSIHLQTGALVASLASLLFRLHLL

Tissue specificity:Expressed in heart, lung, skeletal muscle, kidney, liver, and testis. Not detected in brain and spleen. {ECO:0000269|PubMed:12738806, ECO:0000269|PubMed:31442408}.

Induction:

Developmental stage:

Protein families:Metallo-dependent hydrolases superfamily, Peptidase M19 family


   💬 WhatsApp