PIGP_MOUSE   Q9JHG1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JHG1

Recommended name:Phosphatidylinositol N-acetylglucosaminyltransferase subunit P

EC number:EC 2.4.1.198

Alternative names:(Down syndrome critical region protein 5 homolog) (Phosphatidylinositol-glycan biosynthesis class P protein) (PIG-P)

Cleaved into:

GeneID:56176

Gene names  (primary ):Pigp

Gene names  (synonym ):Dcrc Dscr5

Gene names  (ORF ):

Length:132

Mass:15101

Sequence:MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFVPESWLNSLGLTYWPQKYWAVALPVYLLITVVIGYVLLFGINMMSTSPLDSIHTITDNYAKNQQRKNYQEDAIPALRDVPISEVNKMFFLGAKELNT

Tissue specificity:Expressed in tongue. {ECO:0000269|PubMed:11331941}.

Induction:

Developmental stage:

Protein families:PIGP family


   💬 WhatsApp