RCAN1_MOUSE   Q9JHG6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JHG6

Recommended name:Calcipressin-1

EC number:

Alternative names:(Down syndrome critical region protein 1 homolog) (Myocyte-enriched calcineurin-interacting protein 1) (MCIP1) (Regulator of calcineurin 1)

Cleaved into:

GeneID:54720

Gene names  (primary ):Rcan1

Gene names  (synonym ):Dscr1

Gene names  (ORF ):

Length:251

Mass:28137

Sequence:MEDGVAGPRLGEVAEAVEARAPRRVTLRPFAPFSAAAEGDGGGGGDWSFIDCEMEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDTTFQYFKSFKRVRINFSNPLSAADARLRLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQENEEEEEEMERMKRPKPKIIQTRRPEYTPIHLS

Tissue specificity:Highly expressed in heart and skeletal muscle. Also expressed in all other tissues. {ECO:0000269|PubMed:11231093, ECO:0000269|PubMed:12809556}.

Induction:

Developmental stage:

Protein families:RCAN family


   💬 WhatsApp