RCAN3_MOUSE   Q9JKK0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JKK0

Recommended name:Calcipressin-3

EC number:

Alternative names:(Down syndrome candidate region 1-like protein 2) (Myocyte-enriched calcineurin-interacting protein 3) (MCIP3) (Regulator of calcineurin 3)

Cleaved into:

GeneID:53902

Gene names  (primary ):Rcan3

Gene names  (synonym ):Dscr1l2

Gene names  (ORF ):

Length:239

Mass:27153

Sequence:MLRDSLKSWNDSQSDLCSSDQEEEEEMVFGENEDGLEEMMDLSDLPTSLFACSVHEAVFEVQEQKERFEALFTLYDDQVTFQLFKSFRRVRINFSKPEAAARARIELHESEFHGRKLKLYFAQVQVSGEARDKSYLLPPQPTKQFLISPPASPPVGWKQSEDAMPVINYDLLCAVSKLGPGEKYELHAGTESTPSVVVHVCESETEEEEDTKNPKQKITQTRRPEAPTAALSERLDCAL

Tissue specificity:

Induction:

Developmental stage:

Protein families:RCAN family


   💬 WhatsApp