FA53A_MOUSE   E9PV82


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:E9PV82

Recommended name:Protein FAM53A

EC number:

Alternative names:(Dorsal neural-tube nuclear protein)

Cleaved into:

GeneID:74504

Gene names  (primary ):Fam53a

Gene names  (synonym ):Dntnp

Gene names  (ORF ):

Length:402

Mass:43084

Sequence:MVTLITEKLQNQSLDDLTRRACEAGPYSAEKLNKSGHLFPLEISVDKSPWKALRGGWPTGSQAASGPFSVGPHGVSHTEGLKWQLESPGPMDVGHFLDLHDSTGPPAAPPTKRHCRSLSEPEELARCRSPWRPGSSKVWTPISKRRCNSGGSATLQCCSGVGNPTLQGTLVPGLPRRPVSPAGPTSPLTPRPASASSGFVDGSEGSTSSGPPWLSTGPCPFSSRRRLSLSQEHLVDTGACLPSASSTPTSTPELGRHHGLLRCRSQPCVLDGRRVRRKRRREEDARWTRPSLDFLKMTRTLKNSKSLCSLDYEDDEDDTQEKTLVSSPCNSQGLVGIITPSSSPRIPRPGPDSPSIWASGEPEANPGEGGSSGDPSDWDSAGEEGIFPLDHGDLDLEQIENN

Tissue specificity:

Induction:

Developmental stage:

Protein families:FAM53 family


   💬 WhatsApp