METL9_MOUSE   Q9EPL4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EPL4

Recommended name:Methyltransferase-like protein 9

EC number:

Alternative names:(DORA reverse strand protein) (DREV)

Cleaved into:

GeneID:59052

Gene names  (primary ):Mettl9

Gene names  (synonym ):drev

Gene names  (ORF ):MNCb-5680

Length:318

Mass:36426

Sequence:MRLLAGWLCLSLASVWLARRMWTLRSPLSRSLYVNMTSGPGGPAAAAGGGKDTHQWYVCNREKLCESLQSVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLRINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTQGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVVEAFTRLPYLCEGDMYNDYYVLDDAVFVLRPV

Tissue specificity:Expressed in liver, colon, small intestine, skin, kidney and to a lesser extent in spleen, lung, thymus and stomach. Not detected in fibroblast and endothelial cells. {ECO:0000269|PubMed:11132146}.

Induction:

Developmental stage:

Protein families:DREV family


   💬 WhatsApp