TUSC3_MOUSE   Q8BTV1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BTV1

Recommended name:Tumor suppressor candidate 3

EC number:

Alternative names:(Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TUSC3) (Oligosaccharyl transferase subunit TUSC3) (Magnesium uptake/transporter TUSC3) (Protein N33)

Cleaved into:

GeneID:80286

Gene names  (primary ):Tusc3

Gene names  (synonym ):N33

Gene names  (ORF ):

Length:347

Mass:39548

Sequence:MSARAAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFVKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSSAFCNKLFFGMVDYDEGTDVFQQLNMNSAPTFMHFPSKGRPKRADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSFLIK

Tissue specificity:

Induction:

Developmental stage:

Protein families:OST3/OST6 family


   💬 WhatsApp