HCST_MOUSE   Q9QUJ0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QUJ0

Recommended name:Hematopoietic cell signal transducer

EC number:

Alternative names:(DNAX-activation protein 10) (Membrane protein DAP10) (Transmembrane adapter protein KAP10)

Cleaved into:

GeneID:23900

Gene names  (primary ):Hcst

Gene names  (synonym ):Dap10 Kap10

Gene names  (ORF ):

Length:79

Mass:8114

Sequence:MDPPGYLLFLLLLPVAASQTSAGSCSGCGTLSLPLLAGLVAADAVMSLLIVGVVFVCMRPHGRPAQEDGRVYINMPGRG

Tissue specificity:

Induction:

Developmental stage:

Protein families:DAP10 family


   💬 WhatsApp