RPA12_MOUSE   Q791N7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q791N7

Recommended name:DNA-directed RNA polymerase I subunit RPA12

EC number:

Alternative names:(DNA-directed RNA polymerase I subunit H) (Zinc ribbon domain-containing protein 1)

Cleaved into:

GeneID:66136

Gene names  (primary ):Polr1h

Gene names  (synonym ):Rpa12 Znrd1

Gene names  (ORF ):

Length:123

Mass:13650

Sequence:MELARPRSNFQSDLDFCPDCGSVLPLPGIQDTVICSRCGFSIDVRDCEGKVVKTSVVFNKLGATIPLSVDEGPELQGPVIDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCINCKFQEKEDS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family


   💬 WhatsApp