RPA12_MOUSE Q791N7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q791N7
Recommended name:DNA-directed RNA polymerase I subunit RPA12
EC number:
Alternative names:(DNA-directed RNA polymerase I subunit H) (Zinc ribbon domain-containing protein 1)
Cleaved into:
GeneID:66136
Gene names (primary ):Polr1h
Gene names (synonym ):Rpa12 Znrd1
Gene names (ORF ):
Length:123
Mass:13650
Sequence:MELARPRSNFQSDLDFCPDCGSVLPLPGIQDTVICSRCGFSIDVRDCEGKVVKTSVVFNKLGATIPLSVDEGPELQGPVIDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCINCKFQEKEDS
Tissue specificity:
Induction:
Developmental stage:
Protein families:Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family