RPA43_MOUSE Q78WZ7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q78WZ7
Recommended name：DNA-directed RNA polymerase I subunit RPA43
EC number：
Alternative names：(DNA-directed RNA polymerase I subunit F) (Twist neighbor protein)
Cleaved into：
GeneID：28071
Gene names (primary )：Polr1f
Gene names (synonym )：Twistnb
Gene names (ORF )：
Length：330
Mass：36721
Sequence：MAAGSVESQRSQAASERPVAGQAGVLPCLELPSYAAACALVGSRYSCLVAAPHRRHIALSPRYLSRKRTGIREQLDAELLRYSESLLGVPIAYDNIRVVGELGDIYDDQGHIHLNIEADFVIFCPEPGQTLMGTVNKVSSSHIGCLVHGCFNASIPKPEQMSYEEWQTLEIHVGDELEFDVFRLDSDSAGVFCIRGKLSTTSLQLKHSAVSEDVAETVVEEVVEKTPKKKKKKKDKDTDTCGTVDSVTEVADVTDVTPQEETDIPCSDNVNDFFEEEPKKKKKKKKRHQEDQDPIFQASDSSGYQSDHNKKKKKRKHSEEANFESPKKRQ
Tissue specificity：Widely expressed. {ECO:0000269|PubMed:12438708}.
Induction：
Developmental stage：
Protein families：Eukaryotic RPA43 RNA polymerase subunit family