NEIL2_MOUSE   Q6R2P8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6R2P8

Recommended name:Endonuclease 8-like 2

EC number:EC 3.2.2.-

Alternative names:(DNA glycosylase/AP lyase Neil2) (DNA-(apurinic or apyrimidinic site) lyase Neil2) (Endonuclease VIII-like 2) (Nei homolog 2) (NEH2) (Nei-like protein 2)

Cleaved into:

GeneID:382913

Gene names  (primary ):Neil2

Gene names  (synonym ):Gm1212

Gene names  (ORF ):

Length:329

Mass:36834

Sequence:MPEGPSVRKFHHLVSPFVGQKVVKTGGSSKKLHPAAFQSLWLQDAQVHGKKLFLRFDPDEEMEPLNSSPQPIQGMWQKEAVDRELALGPSAQEPSAGPSGSGEPVPSRSAETYNLGKIPSADAQRWLEVRFGLFGSIWVNDFSRAKKANKKGDWRDPVPRLVLHFSGGGFLVFYNCQMSWSPPPVIEPTCDILSEKFHRGQALEALSQAQPVCYTLLDQRYFSGLGNIIKNEALYRARIHPLSLGSCLSSSSREALVDHVVEFSKDWLRDKFQGKERHTQIYQKEQCPSGHQVMKETFGPPDGLQRLTWWCPQCQPQLSSKGPQNLPSS

Tissue specificity:

Induction:

Developmental stage:

Protein families:FPG family


   💬 WhatsApp