DIRA1_MOUSE   Q91Z61


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91Z61

Recommended name:GTP-binding protein Di-Ras1

EC number:

Alternative names:(Distinct subgroup of the Ras family member 1) (Small GTP-binding tumor suppressor 1)

Cleaved into:

GeneID:208666

Gene names  (primary ):Diras1

Gene names  (synonym ):Gbts1

Gene names  (ORF ):

Length:198

Mass:22265

Sequence:MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLDELSPIYKLIVQIKGSVEDIPIMLVGNKCDETQREVHTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRSVSLSVDGKRSSKQKRADRIKGKCALM

Tissue specificity:

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Di-Ras family


   💬 WhatsApp