TMM91_MOUSE   Q8C581


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8C581

Recommended name:Transmembrane protein 91

EC number:

Alternative names:(Dispanin subfamily C member 3) (DSPC3) (Synapse differentiation-induced protein 3)

Cleaved into:

GeneID:320208

Gene names  (primary ):Tmem91

Gene names  (synonym ):SynDIG3

Gene names  (ORF ):

Length:172

Mass:18085

Sequence:MDNSSIQELQQPLLPSITCDLLAPRSEKPELGTPFPETAFAESPRGWQLLLPPLPSVSAGLGEPETPDFEDTLSSDSDSDDDGGDRLSPLLPHDHLGLAVFSVLCCFWPVGIAAFCLAHKTNKAWAKGDVQGAGAASRRAFLLGVLAVGLGLCTYAAALVTLAAYLASRDPP

Tissue specificity:

Induction:

Developmental stage:

Protein families:CD225/Dispanin family


   💬 WhatsApp