NUD11_MOUSE   P0C028


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C028

Recommended name:Diphosphoinositol polyphosphate phosphohydrolase 3-beta

EC number:EC 3.6.1.52

Alternative names:(DIPP-3-beta) (DIPP3-beta) (Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-beta) (Diadenosine hexaphosphate hydrolase (AMP-forming)) (Nucleoside diphosphate-linked moiety X motif 11) (Nudix motif 11)

Cleaved into:

GeneID:102954

Gene names  (primary ):Nudt11

Gene names  (synonym ):Dipp3b

Gene names  (ORF ):MNCb-1696

Length:164

Mass:18593

Sequence:MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPDGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVFVLTVTELLEDWEDSVSIGRKREWFKIEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSAAPSPPESEP

Tissue specificity:Predominantly expressed in brain and is weakly or not expressed in other tissues. {ECO:0000269|PubMed:12689335}.

Induction:

Developmental stage:

Protein families:Nudix hydrolase family, DIPP subfamily


   💬 WhatsApp