NUD10_MOUSE   P0C027


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C027

Recommended name:Diphosphoinositol polyphosphate phosphohydrolase 3-alpha

EC number:EC 3.6.1.52

Alternative names:(DIPP-3-alpha) (DIPP3-alpha) (Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-alpha) (Diadenosine hexaphosphate hydrolase (AMP-forming)) (Nucleoside diphosphate-linked moiety X motif 10) (Nudix motif 10)

Cleaved into:

GeneID:102954

Gene names  (primary ):Nudt10

Gene names  (synonym ):Dipp3a

Gene names  (ORF ):

Length:164

Mass:18593

Sequence:MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPDGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKHRTYVFVLTVTELLEDWEDSVSIGRKREWFKIEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSAAPSPPESEP

Tissue specificity:Mainly expressed in testis, liver kidney and, at lower level, in heart, brain, spleen, lung and skeletal muscle. {ECO:0000269|PubMed:12689335}.

Induction:

Developmental stage:

Protein families:Nudix hydrolase family, DIPP subfamily


   💬 WhatsApp